PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C020611P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 338aa    MW: 36910.1 Da    PI: 5.8557
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C020611P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.15.4e-30158211155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     +prl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  MELO3C020611P1 158 RPRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 211
                     59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.061155214IPR017930Myb domain
SuperFamilySSF466891.67E-19155215IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-30157216IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-23159211IPR006447Myb domain, plants
PfamPF002496.0E-8161210IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MGEEVKMAEY ESGGGGGGGE DESCAHEERV FEWETGLPDA DDLTPLSQTL IPPELASAFS  60
ISTGPCRTLM DVNRASQNTL SNLRGFQAQA FSSNNFKSFN DDRTQDHDPM VVEGDEATER  120
DAGSDSRKLR KVDCAEEADS ALRTDNSMDD PSARTLKRPR LVWTPQLHKR FVDVVAHLGI  180
KNAVPKTIMQ LMNVEGLTRE NVASHLQKYR LYLKRMQGSS NEGPSSPDRI FASTPVPQTL  240
HESTNSGQAN GNGHLPVPTP MPYGPPMMPM PVLGMAASGH AHSYMGMPVA HPGSAQGYPG  300
FETHPFNMMH QRDWSGNKYS SIVPYPHPHV PPNTNDK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-20157216463ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819260.0LN681926.1 Cucumis melo genomic scaffold, anchoredscaffold00044.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008457454.10.0PREDICTED: transcription factor PCL1-like
RefseqXP_008457455.10.0PREDICTED: transcription factor PCL1-like
SwissprotQ9SNB42e-85PCL1_ARATH; Transcription factor LUX
TrEMBLA0A0A0LXF60.0A0A0A0LXF6_CUCSA; Uncharacterized protein
STRINGVIT_06s0004g05120.t011e-146(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69573347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.22e-80G2-like family protein